PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0647s0018.8.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 501aa    MW: 55503.5 Da    PI: 6.1387
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0647s0018.8.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like888.7e-28305359156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k +++Wt++LH++Fv+aveqL G ++A+P++ilelmkv+gLt+++v+SHLQkYR++
  Kalax.0647s0018.8.p 305 KMKVDWTSDLHKKFVQAVEQL-GVDQAIPSRILELMKVEGLTRHNVASHLQKYRMH 359
                          5689*****************.********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23005.2E-1216145No hitNo description
SuperFamilySSF521724.7E-1116132IPR011006CheY-like superfamily
PROSITE profilePS5011017.82919132IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.7E-520126IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5129413.671302361IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-27302361IPR009057Homeodomain-like
SuperFamilySSF466898.96E-18303361IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-25305359IPR006447Myb domain, plants
PfamPF002491.9E-7308357IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MVCTADELLE WEDFPKGLRV LLLDRDVNYA SEIRSKLEGM DYIVSTFCDE DEALSAVLSN  60
SEVFHVAIVE VSTVKCDGSF KFLQMAKGLP TVMTASAQCL TTTMKCIALG AIEVLNKPIC  120
EDKLRNIWQH VVHKAYSAVA ESPRQESTVR MVKDEEIRDK LRGGMPCLFD GGCNDEHDRS  180
PGDDKYPAPS TPQLKQVRLL DDAGFHDQTN WSSEKDSVAH YEESKSVETT SCNAAPDMPL  240
EAGEQMHESV VKEENNSADG CKSESDTSPA QKNEAETSSL GGNTRKQSKV SESRSPCGAK  300
TNRKKMKVDW TSDLHKKFVQ AVEQLGVDQA IPSRILELMK VEGLTRHNVA SHLQKYRMHR  360
RHALPKREER RISACPVWAT PRSHTSGLHA WGPPYQTWPW KTCAAADAWG CPVMPPLHGS  420
YSYYPQQNGY NGGVDISRNS MPPNSHNDHH LADEVVDQIV KEAISKPWLP LPLGLQPPST  480
ESVLSELSKQ GISSIPPPSQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-16301358158ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279150.10.0PREDICTED: two-component response regulator-like APRR2
SwissprotQ6LA431e-120APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLF6HTC70.0F6HTC7_VITVI; Putative uncharacterized protein
STRINGVIT_02s0012g00570.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-123ARR-B family protein